Your Cart
Peptide Calculator Tool
Check Order Status
My Account Login / Register
Login Register Wishlist Edit your wishlist0 Blog Research Hub
Back Account
Login Register ⋯
FAQ Demos About us Contact
home Product Bundles TB500 + BPC157 Bundle
TB500 + BPC157 Bundle
5 x BPC 5mg Vials
BPC-157 5mg Thymosin Beta 4 2mg (TB500)
BPC-157 5mg - Research Peptide
BPC 157, offered at 5mg is a unique, specialised research peptide developed for advanced scientific exploration in tissue. This product is ideal for laboratory settings where precision and reliability are paramount.
Product Name: BPC-157 5mg Catalogue Number: BPC5-024 Molecular Formula: C62H98N16O22 Molecular Weight: 1479.6 g/mol Purity: 99% Sequence: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH Form: Lyophilised Solid
View PeptideVerify Certificate
Usage and Storage:
BPC-157 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance:
BPC-157 is meticulously synthesised through a controlled process that guarantees high purity and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards that researchers require.
Why Choose UK Peptides for BPC-157 in the UK?
Since 2012, UK Peptides has been a trusted name in the peptide industry. Our reputation for delivering high-purity peptides suitable for research is backed by over a decade of experience. Unlike many other suppliers, we work directly with our trusted manufacturer, ensuring that each batch meets the highest standards for quality and purity. We do not purchase from third-party resellers, which allows us to maintain consistency, reliability, and unmatched product quality in every vial.
Legal and Safety Information:
UK-Peptides proudly provides BPC-157 strictly for scientific and research use. We are dedicated to supporting the research community and ensuring our products meet stringent quality standards and legal requirements. Please note that our peptides, including BPC-157, are not designed for human consumption or clinical application.
If you require high-quality BPC 157 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.
TB-500 2mg - High-Quality Research Peptide
TB-500, offered at 2mg, is a high-quality specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.
Product Name: TB-500 2mg Catalogue Number: TB500-2mg Molecular Formula: C212H350N56O78S Molecular Weight: 4963.4 g/mol Purity: ≥98% Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Form: Lyophilised Solid
Usage and Storage:
TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance:
TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.
If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.