Entry
281239 CDS T01008 Symbol
IGF1 Name
(RefSeq) insulin-like growth factor I preproprotein KO
K05459 insulin-like growth factor 1 Organism
bta Bos taurus (cow) Pathway
bta01521 EGFR tyrosine kinase inhibitor resistance
bta01522 Endocrine resistance
bta04010 MAPK signaling pathway
bta04014 Ras signaling pathway
bta04015 Rap1 signaling pathway
bta04066 HIF-1 signaling pathway
bta04068 FoxO signaling pathway
bta04081 Hormone signaling
bta04114 Oocyte meiosis
bta04115 p53 signaling pathway
bta04150 mTOR signaling pathway
bta04151 PI3K-Akt signaling pathway
bta04152 AMPK signaling pathway
bta04211 Longevity regulating pathway
bta04213 Longevity regulating pathway - multiple species
bta04510 Focal adhesion
bta04518 Integrin signaling
bta04550 Signaling pathways regulating pluripotency of stem cells
bta04730 Long-term depression
bta04750 Inflammatory mediator regulation of TRP channels
bta04913 Ovarian steroidogenesis
bta04914 Progesterone-mediated oocyte maturation
bta04935 Growth hormone synthesis, secretion and action
bta04960 Aldosterone-regulated sodium reabsorption
bta05200 Pathways in cancer
bta05202 Transcriptional misregulation in cancer
bta05205 Proteoglycans in cancer
bta05214 Glioma
bta05215 Prostate cancer
bta05218 Melanoma
bta05224 Breast cancer
bta05410 Hypertrophic cardiomyopathy
bta05414 Dilated cardiomyopathy Brite
KEGG Orthology (KO) [BR:bta00001] 09130 Environmental Information Processing 09132 Signal transduction 04010 MAPK signaling pathway 281239 (IGF1) 04014 Ras signaling pathway 281239 (IGF1) 04015 Rap1 signaling pathway 281239 (IGF1) 04066 HIF-1 signaling pathway 281239 (IGF1) 04068 FoxO signaling pathway 281239 (IGF1) 04151 PI3K-Akt signaling pathway 281239 (IGF1) 04152 AMPK signaling pathway 281239 (IGF1) 04150 mTOR signaling pathway 281239 (IGF1) 09133 Signaling molecules and interaction 04081 Hormone signaling 281239 (IGF1) 04518 Integrin signaling 281239 (IGF1) 09140 Cellular Processes 09143 Cell growth and death 04114 Oocyte meiosis 281239 (IGF1) 04115 p53 signaling pathway 281239 (IGF1) 09144 Cellular community - eukaryotes 04510 Focal adhesion 281239 (IGF1) 04550 Signaling pathways regulating pluripotency of stem cells 281239 (IGF1) 09150 Organismal Systems 09152 Endocrine system 04913 Ovarian steroidogenesis 281239 (IGF1) 04914 Progesterone-mediated oocyte maturation 281239 (IGF1) 04935 Growth hormone synthesis, secretion and action 281239 (IGF1) 09155 Excretory system 04960 Aldosterone-regulated sodium reabsorption 281239 (IGF1) 09156 Nervous system 04730 Long-term depression 281239 (IGF1) 09157 Sensory system 04750 Inflammatory mediator regulation of TRP channels 281239 (IGF1) 09149 Aging 04211 Longevity regulating pathway 281239 (IGF1) 04213 Longevity regulating pathway - multiple species 281239 (IGF1) 09160 Human Diseases 09161 Cancer: overview 05200 Pathways in cancer 281239 (IGF1) 05202 Transcriptional misregulation in cancer 281239 (IGF1) 05205 Proteoglycans in cancer 281239 (IGF1) 09162 Cancer: specific types 05214 Glioma 281239 (IGF1) 05218 Melanoma 281239 (IGF1) 05215 Prostate cancer 281239 (IGF1) 05224 Breast cancer 281239 (IGF1) 09166 Cardiovascular disease 05410 Hypertrophic cardiomyopathy 281239 (IGF1) 05414 Dilated cardiomyopathy 281239 (IGF1) 09176 Drug resistance: antineoplastic 01521 EGFR tyrosine kinase inhibitor resistance 281239 (IGF1) 01522 Endocrine resistance 281239 (IGF1) 09180 Brite Hierarchies 09183 Protein families: signaling and cellular processes 04052 Cytokines and neuropeptides [BR:bta04052] 281239 (IGF1) Cytokines and neuropeptides [BR:bta04052] Cytokines Growth factors (RTK binding) 281239 (IGF1) SSDB Motif
Pfam: Insulin Other DBs
NCBI-GeneID: 281239
NCBI-ProteinID: NP_001071296
BGD-bta: BT11525
Ensembl: ENSBTAG00000011082
VGNC: 30076
UniProt: P07455 F2X2F0 Position
5 AA seq 154 aa MGKISSLPTQLFKCCFCDFLKQVKMPITSSSHLFYLALCLLAFTSSATAGPETLCGAELV DALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAR SVRAQRHTDMPKAQKEVHLKNTSRGSAGNKNYRM NT seq 465 nt +upstreamnt +downstreamnt atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg aagcaggtgaagatgcccatcacatcctcctcgcatctcttctatctggccctgtgcttg ctcgccttcaccagctctgccacggcgggacccgagaccctctgcggggctgagttggtg gatgctctccagttcgtgtgcggagacaggggcttttatttcaacaagcccacggggtat ggctcgagcagtcggagggcgccccagacaggaatcgtggatgagtgctgcttccggagc tgtgatctgaggaggctggagatgtactgcgcgcctctcaagcccgccaagtcggcccgc tcagtccgtgcccagcgccacaccgacatgcccaaggctcagaaggaagtacatttgaag aacacaagtagagggagtgcaggaaacaagaactacagaatgtag