Entry
16000 CDS T01002 Symbol
Igf1, C730016P09Rik, Igf-1, Igf-I Name
(RefSeq) insulin-like growth factor I isoform 4 preproprotein KO
K05459 insulin-like growth factor 1 Organism
mmu Mus musculus (house mouse) Pathway
mmu01521 EGFR tyrosine kinase inhibitor resistance
mmu01522 Endocrine resistance
mmu04010 MAPK signaling pathway
mmu04014 Ras signaling pathway
mmu04015 Rap1 signaling pathway
mmu04066 HIF-1 signaling pathway
mmu04068 FoxO signaling pathway
mmu04081 Hormone signaling
mmu04114 Oocyte meiosis
mmu04115 p53 signaling pathway
mmu04150 mTOR signaling pathway
mmu04151 PI3K-Akt signaling pathway
mmu04152 AMPK signaling pathway
mmu04211 Longevity regulating pathway
mmu04213 Longevity regulating pathway - multiple species
mmu04510 Focal adhesion
mmu04518 Integrin signaling
mmu04550 Signaling pathways regulating pluripotency of stem cells
mmu04730 Long-term depression
mmu04750 Inflammatory mediator regulation of TRP channels
mmu04913 Ovarian steroidogenesis
mmu04914 Progesterone-mediated oocyte maturation
mmu04935 Growth hormone synthesis, secretion and action
mmu04960 Aldosterone-regulated sodium reabsorption
mmu05200 Pathways in cancer
mmu05202 Transcriptional misregulation in cancer
mmu05205 Proteoglycans in cancer
mmu05214 Glioma
mmu05215 Prostate cancer
mmu05218 Melanoma
mmu05224 Breast cancer
mmu05410 Hypertrophic cardiomyopathy
mmu05414 Dilated cardiomyopathy Brite
KEGG Orthology (KO) [BR:mmu00001] 09130 Environmental Information Processing 09132 Signal transduction 04010 MAPK signaling pathway 16000 (Igf1) 04014 Ras signaling pathway 16000 (Igf1) 04015 Rap1 signaling pathway 16000 (Igf1) 04066 HIF-1 signaling pathway 16000 (Igf1) 04068 FoxO signaling pathway 16000 (Igf1) 04151 PI3K-Akt signaling pathway 16000 (Igf1) 04152 AMPK signaling pathway 16000 (Igf1) 04150 mTOR signaling pathway 16000 (Igf1) 09133 Signaling molecules and interaction 04081 Hormone signaling 16000 (Igf1) 04518 Integrin signaling 16000 (Igf1) 09140 Cellular Processes 09143 Cell growth and death 04114 Oocyte meiosis 16000 (Igf1) 04115 p53 signaling pathway 16000 (Igf1) 09144 Cellular community - eukaryotes 04510 Focal adhesion 16000 (Igf1) 04550 Signaling pathways regulating pluripotency of stem cells 16000 (Igf1) 09150 Organismal Systems 09152 Endocrine system 04913 Ovarian steroidogenesis 16000 (Igf1) 04914 Progesterone-mediated oocyte maturation 16000 (Igf1) 04935 Growth hormone synthesis, secretion and action 16000 (Igf1) 09155 Excretory system 04960 Aldosterone-regulated sodium reabsorption 16000 (Igf1) 09156 Nervous system 04730 Long-term depression 16000 (Igf1) 09157 Sensory system 04750 Inflammatory mediator regulation of TRP channels 16000 (Igf1) 09149 Aging 04211 Longevity regulating pathway 16000 (Igf1) 04213 Longevity regulating pathway - multiple species 16000 (Igf1) 09160 Human Diseases 09161 Cancer: overview 05200 Pathways in cancer 16000 (Igf1) 05202 Transcriptional misregulation in cancer 16000 (Igf1) 05205 Proteoglycans in cancer 16000 (Igf1) 09162 Cancer: specific types 05214 Glioma 16000 (Igf1) 05218 Melanoma 16000 (Igf1) 05215 Prostate cancer 16000 (Igf1) 05224 Breast cancer 16000 (Igf1) 09166 Cardiovascular disease 05410 Hypertrophic cardiomyopathy 16000 (Igf1) 05414 Dilated cardiomyopathy 16000 (Igf1) 09176 Drug resistance: antineoplastic 01521 EGFR tyrosine kinase inhibitor resistance 16000 (Igf1) 01522 Endocrine resistance 16000 (Igf1) 09180 Brite Hierarchies 09183 Protein families: signaling and cellular processes 04052 Cytokines and neuropeptides [BR:mmu04052] 16000 (Igf1) Cytokines and neuropeptides [BR:mmu04052] Cytokines Growth factors (RTK binding) 16000 (Igf1) SSDB Motif
Pfam: Insulin Other DBs
NCBI-GeneID: 16000
NCBI-ProteinID: NP_001104745
MGI: 96432
Ensembl: ENSMUSG00000020053
UniProt: P05017 Q4VJC0 Position
10:87694127..87772909 AA seq 153 aa MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVD ALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARS IRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM NT seq 462 nt +upstreamnt +downstreamnt atggggaaaatcagcagccttccaactcaattatttaagatctgcctctgtgacttcttg aagataaagatacacatcatgtcgtcttcacacctcttctacctggcgctctgcttgctc accttcaccagctccaccacagctggaccagagaccctttgcggggctgagctggtggat gctcttcagttcgtgtgtggaccgaggggcttttacttcaacaagcccacaggctatggc tccagcattcggagggcacctcagacaggcattgtggatgagtgttgcttccggagctgt gatctgaggagactggagatgtactgtgccccactgaagcctacaaaagcagcccgctct atccgtgcccagcgccacactgacatgcccaagactcagaaggaagtacatttgaagaac acaagtagaggaagtgcaggaaacaagacctacagaatgtag