Manufactured by BioVendor
Regulatory status:RUO Type:Monoclonal Antibody Other names:Growth/differentiation factor 8, GDF-8, MSTN Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price 1 pc / 2 - 5 pcs / 6+ pcs RD1820571006E8 0.1 mg $300 / $266 / On request
PubMed Product Details
Technical Data
Type
Monoclonal Antibody
Applications
Western blotting, Immunohistochemistry
Antibodies Applications
Source of Antigen
E. coli
Hosts
Mouse
Isotype
IgG2b
Preparation
The antibody is a mouse monoclonal antibody against recombinant Human Myostatin Propeptide.
Amino Acid Sequence
The immunization antigen (28 kDa) is a protein containing 243 AA of recombinant Human Myostatin Propeptide and 5 extra AA.
MGNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRKLN
The amino acid sequence of the recombinant Human Myostatin Propeptide is 100% homologous with the amino acid sequence of the Human Myostatin Propeptide without signaling sequence
Species Reactivity
Human. Not yet tested in other species.
Purification Method
Affinity chromatography on a column with immobilized protein G.
Antibody Content
0.1 mg (determined by BCA method, BSA was used as a standard)
Formulation
The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.
Reconstitution
Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.
Quality Control Test
Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody
Note
This product is for research use only.
Summary
Research topic
Cardiovascular disease, Energy metabolism and body weight regulation, Muscle growth and physiology regulation, Pulmonary diseases
Summary
Myostatin (GDF 8) is expressed uniquely in human skeletal muscle as a 12 kDa mature glycoprotein consisting of 109 amino acid residues and secreted into plasma. Myostatin is a member of the transforming growth factor β superfamily of secreted growth and differentiation factors that is essential for proper regulation of skeletal muscle mass. Studies have shown that myostatin could play an important role in cardiac development and physiology. In serum, myostatin circulates as part of a latent complex containing myostatin propeptide and/or follistatin-related gene. The myostatin propeptide is known to bind and inhibit myostatin in vitro. This interaction is relevant in vivo, with a majority (>70%) of myostatin in serum bound to its propeptide. The myostatin propeptide is negative regulator of myostatin in vivo.
Product References (1)
References
Diel P, Schiffer T, Geisler S, Hertrampf T, Mosler S, Schulz S, Wintgens KF, Adler M. Analysis of the effects of androgens and training on myostatin propeptide and follistatin concentrations in blood and skeletal muscle using highly sensitive immuno PCR. Mol Cell Endocrinol. 2010 Dec 15;330(1-2):1-9. doi: 10.1016/j.mce.2010.08.015. Epub 2010 Aug 27. PubMed PMID: 20801187. See more on PubMed
Summary References (9)
References to Myostatin
Artaza JN, Bhasin S, Magee TR, Reisz-Porszasz S, Shen R, Groome NP, Meerasahib MF, Gonzalez-Cadavid NF. Myostatin inhibits myogenesis and promotes adipogenesis in C3H 10T(1/2) mesenchymal multipotent cells. Endocrinology. 2005 Aug;146 (8):3547-57 Gonzalez-Cadavid NF, Taylor WE, Yarasheski K, Sinha-Hikim I, Ma K, Ezzat S, Shen R, Lalani R, Asa S, Mamita M, Nair G, Arver S, Bhasin S. Organization of the human myostatin gene and expression in healthy men and HIV-infected men with muscle wasting. Proc Natl Acad Sci U S A. 1998 Dec 8;95 (25):14938-43 Hill JJ, Davies MV, Pearson AA, Wang JH, Hewick RM, Wolfman NM, Qiu Y. The myostatin propeptide and the follistatin-related gene are inhibitory binding proteins of myostatin in normal serum. J Biol Chem. 2002 Oct 25;277 (43):40735-41 Jiang MS, Liang LF, Wang S, Ratovitski T, Holmstrom J, Barker C, Stotish R. Characterization and identification of the inhibitory domain of GDF-8 propeptide. Biochem Biophys Res Commun. 2004 Mar 12;315 (3):525-31 Lee SJ, McPherron AC. Regulation of myostatin activity and muscle growth. Proc Natl Acad Sci U S A. 2001 Jul 31;98 (16):9306-11 McPherron AC, Lee SJ. Double muscling in cattle due to mutations in the myostatin gene. Proc Natl Acad Sci U S A. 1997 Nov 11;94 (23):12457-61 Sharma M, Kambadur R, Matthews KG, Somers WG, Devlin GP, Conaglen JV, Fowke PJ, Bass JJ. Myostatin, a transforming growth factor-beta superfamily member, is expressed in heart muscle and is upregulated in cardiomyocytes after infarct. J Cell Physiol. 1999 Jul;180 (1):1-9 Taylor WE, Bhasin S, Artaza J, Byhower F, Azam M, Willard DH Jr, Kull FC Jr, Gonzalez-Cadavid N. Myostatin inhibits cell proliferation and protein synthesis in C2C12 muscle cells. Am J Physiol Endocrinol Metab. 2001 Feb;280 (2):E221-8 Thies RS, Chen T, Davies MV, Tomkinson KN, Pearson AA, Shakey QA, Wolfman NM. GDF-8 propeptide binds to GDF-8 and antagonizes biological activity by inhibiting GDF-8 receptor binding. Growth Factors. 2001;18 (4):251-9
Related Products
Docs
Find documents for the lot
Product Datasheet (RUO)
Datasheet PDF (RUO)
Safety Information (RUO)
MSDS (RUO)
Western Blot
Western Blot