Sermorelin 5MG
Buy 3 for $44.99 each and save 10%
Buy 5 for $39.99 each and save 20%
Buy 10 for $34.99 each and save 30%
Buy this product and Earn 50.00 Reward Points click here to login
FREE Shipping for orders over $200
For this product you will need: BACTERIOSTATIC WATER For reconstitution.
Sarms
Stacks
Research Liquids
Albuterol 5MG/ML | 30ML with dropper
Anastrozole 1.5MG/ML | 30ML with dropper
Clomiphene 50MG/ML | 30ML with dropper
Finasteride 5MG/ML | 30ML with dropper
Letrozole 3.5 MG/ML | 30ML with dropper
LiquiCia 30MG/ML | 30ML with dropper
LiquiCia T50 50MG/ML | 30ML with dropper
LiquiClen 200MCG/ML | 30ML with dropper
Liquistane / Exemestane 25MG/ML | 30ML with dropper
LiquiTamo 20MG/ML | 30ML with dropper
LiquiVia 25MG/ML | 30 ML with dropper
T3 LIOTHYRONINE 200MCG/ML | 30ML with dropper
Toremifene Citrate 60MG/ML | 30ML with dropper
Yohimbine HCL 10MG/ML | 30ML with dropper
Research Peptides
Aicar 50MG
BPC-157 + TB-500 Blend 2mg ea/ 4MG
BPC-157 5MG
CJC-1295 + DAC 2MG
CJC-1295 | No DAC 2MG
Epithalon 10MG
Frag Premium 176-191 5MG
GHK-CU Copper Peptide 50MG
GHRP-2 5MG
GHRP-6 5MG
Hexarelin 5MG
IGF-1 DES 1MG
IGF-1 LR3 1MG
Ipamorelin 5MG
Melanotan 2 10MG
NAD+ 500MG
PT-141 / Bremelanotide 10MG
GLP-1/GIP/GCG (RT)
Selank 5MG
GLP1 (SM)
Sermorelin 5MG
TB-500 5MG
Tesamorelin
GIP/GLP-1 (TZ)
PDE5 Inhibitors
GLP-1
Diluents
Bacteriostatic Water 10ML
What Is Sermorelin 5MG?
Sermorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). It binds with GHRH receptors in the pituitary gland and triggers growth hormone release and production. Besides promoting growth, it has the additional benefit of reducing scarring following a heart attack, increasing bone density, improving renal function and reducing seizure activity.
IFDA approved Sermorelin in 1997 for the treatment of growth hormone deficiency in children. It was sold under the brand name Geref. Later, FDA withdrew its approval in 2008 because of commercial reasons. Currently, scientists are interested in exploring its effect on sleep, brain tumor and heart health. Right now, sermorelin for sale is available for research purposes only.
Structure Of Sermorelin 5MG
From Pubchem
Synonym: Sermorelina, 86168-78-7, SomatoliberinMolecular Formula: C149H246N44O42SMolecular Weight: 3357.9 g/molSequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRCAS Number: 86168-78-7PubChem CID: 16132413
Sermorelin 5MG Uses In Research
1. Sermorelin and Growth Hormone Deficiency
Because of its growth hormone-releasing properties, it can be used in people with this hormone deficiency. In fact, it is preferred over the administration of synthetic growth hormone (GH). It mimics the process by which the human body naturally produces GH in an episodic and intermittent manner rather than constant levels achieved by injecting GH.
Also, sermorelin is subject to the negative feedback mechanism which involves somatostatin, an inhibitor of growth hormone, to prevent unwanted side effects associated with improper dosing. Further, it can avoid tachyphylaxis, loss of drug response after repeated or continued exposure, unlike exogenous GH administration [1].
2. Sermorelin and Antiaging
Levels of growth hormone and GHRH decline with advancing age. Sermorelin can be effectively used to treat growth hormone deficiency in adults. It stimulates the production of IGF-1 in the liver and increases pituitary preserve, thus preserving the hormone neuroendocrine axis and youthful physiology [1].
In a randomized single-blind placebo-controlled trial, participants involving elderly men and women self-injected placebo for 4 weeks followed by GHRH analog administration for sixteen weeks. GHRG analog administration at night resulted in an acute increase in growth hormone within 10 minutes that lasted for up to 2 hours. This effect was sustained during the course of the whole study. Further, researchers observed elevated IGF-1 and IGFBP3 levels, increased skin thickness and lean body mass. However, only men experienced improved insulin sensitivity and libido, suggesting that the treatment has a more pronounced effect on women than men [2].
3. Sermorelin and Cardiac Remodeling
Research shows that sermorelin can prevent cardiac remodeling and reduce scarring after myocardial infarction. In a study conducted on swine, twenty-five subjects (25 to 30kg) with ischemic cardiomyopathy induced by occlusion of the left descending coronary artery were randomized to either receive a placebo or GHRH analog. The result found that the administration of GHRH analog significantly reduced the size of the infarct and improved diastolic strain. Further, it was suggested that local activation of the GHRH pathway resulted in the repairing process [3].
4. Sermorelin and Sleep
IResearch shows that sleep loss might be related to cognitive decline associated with age. GHRH analog administration has been shown to improve sleep, which might stem from its beneficial effects on cognition [4].
Further, it was suggested that orexin is important for sleep cycle regulation. Studies indicate that the administration of GHRH analogs, sermorelin, can enhance orexin secretion [5].
5. Summary
Sermorelin was first approved for the treatment of growth hormone deficiency in children in 1997. But later, its sale was withheld. Currently, it has been researched for its effect on the treatment of sleep, myocardial infarction and age-related problems. We don’t support its unwarranted medical use and offer sermorelin purchase only for research and educational institutions. So if you are a researcher looking to explore its potential therapeutic use, buy sermorelin from Element Sarms.
Referenced Citations
Walker, R.F., Sermorelin: A better approach to management of adult-onset growth hormone insufficiency? Clinical Interventions in Aging, 2006. 1(4): p. 307-308.
Khorram, O., G.A. Laughlin, and S.S. Yen, Endocrine and metabolic effects of long-term administration of [Nle27]growth hormone-releasing hormone-(1-29)-NH2 in age-advanced men and women. J Clin Endocrinol Metab, 1997. 82(5): p. 1472-9.
Bagno, L.L., et al., Growth hormone-releasing hormone agonists reduce myocardial infarct scar in swine with subacute ischemic cardiomyopathy. J Am Heart Assoc, 2015. 4(4).
Benedict, C., C.D. Chapman, and H.B. Schiöth, Growth Hormone–Releasing Hormone Improves Cognitive Function in Older Adults: Sleep On It. JAMA Neurology, 2013. 70(4): p. 529-530.
BShepherd, B.S., et al., Endocrine and orexigenic actions of growth hormone secretagogues in rainbow trout (Oncorhynchus mykiss). Comparative Biochemistry and Physiology Part A: Molecular & Integrative Physiology, 2007. 146(3): p. 390-399.
Certificate of Analysis (COA)
High Performance Liquid Chromatography (HPLC)
SERMORELIN 5MG — Research Grade
C149H246N44O42S
3357.9 g/mol
86168-78-7
ES-SER-5
Sermorelin (GHRH 1-29 NH2) is a synthetic 29-amino acid peptide corresponding to the N-terminal fragment of endogenous GHRH. It represents the shortest characterised fragment of GHRH retaining full binding activity at the GHRH receptor, making it a highly selective molecular tool for in vitro GHRHR pharmacology studies.
Used in cell-based research examining GHRHR-dependent cAMP production, downstream phosphorylation events, and GH gene transcription activation. In vitro binding assays have characterised receptor affinity, competitive displacement profile, and desensitisation kinetics relative to full-length GHRH.
Element SARMs supplies Sermorelin at 5mg per vial. USA-manufactured via solid-phase methodology and verified at 99%+ purity by HPLC and Mass Spectrometry. Reconstitution with bacteriostatic water required. Store lyophilised at -20C; stable 24 months.
WARNING: For research purposes only. Not for human or animal consumption. Not intended to diagnose, treat, cure, or prevent any disease. For use by qualified research professionals only.
Submit your review to Earn 50 Reward Points click here to login