Shop IGF-1 LR3 1mg from Eternal Peptides. IGF-1 LR3 is a recombinant 83-amino-acid peptide supplied as a lyophilized powder. Synthesized to ≥99% purity, with every lot supported by an independent Janoshik COA and full batch traceability. Fast, secure Fedex shipping, free on orders over $200. Sold for research use only.
IGF-1 LR3 Peptide Characteristics
Property Description Name IGF-1 LR3 (recombinant IGF-1 analogue; Arg3 substitution, N-terminal 13-aa extension) Sequence MFPAMPLLSLFVNPSRGVDEPSFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molecular Weight 9,117.5 g/mol Molecular Formula C400H625N111O116S9 PubChem CID n/a (CAS: 946870-92-4) Product Form Lyophilized powder supplied in 1 mg research vials Purity Typically ≥99%, verified via lot-specific Certificate of Analysis (COA) Solubility Soluble in sterile water or dilute acetic acid; gentle mixing Storage Lyophilized 2-8°C, or at/below -18°C extended; reconstituted 2-8°C
COA and Quality Assurance
Eternal Peptides provides a lot-specific Certificate of Analysis for every IGF-1 LR3 lot. Each COA documents identity by HPLC and/or mass spectrometry, purity, and, where applicable, sterility and endotoxin levels, plus lot-specific storage guidance. Testing is conducted by independent third-party laboratories including Janoshik. COAs are lot-traceable and available on the Lab Tests page.
Handling and Storage
Store unopened IGF-1 LR3 vials at 36-46°F (2-8°C) for routine laboratory storage or at 0°F (-18°C) or below for longer-term preservation. Keep vials tightly sealed and protected from light, heat, and moisture until needed for research. When preparing a working solution, use an appropriate sterile reconstitution solution or compatible laboratory buffer in accordance with validated laboratory procedures. Prepared solutions may be maintained under refrigerated or frozen conditions as required by the research protocol, with aliquoting commonly used to help preserve sample integrity by minimizing repeated freeze-thaw cycles. Always follow institutional biosafety, laboratory handling, and disposal requirements.
Legal and Regulatory Disclaimer
IGF-1 LR3 is supplied strictly for laboratory research use only. It is not approved for human or veterinary use, clinical administration, therapeutic applications, or diagnostic procedures of any kind. Its safety, efficacy, and appropriate handling in humans or animals have not been established. Purchasers are responsible for compliance with all applicable local, state, and federal laws and institutional biosafety regulations.
Dr. Sony Sherpa, MBBS, MD
Medical author
Dr. Sony Sherpa holds a medical degree (MBBS, MD) and writes on peptide characterisation, chemical and structural data, and laboratory handling and storage. Her focus is on accuracy and fidelity to current published research, with all content presented for laboratory research use only. Read full profile