AustralianPeptide Labs
Compounds Tesamorelin 10mg
Research Grade
$100
1
Molecular Details
Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular Formula:C221H366N72O67S
Molecular Weight:5135.8 Da
Purity:99%
CAS Number:218949-48-5
Form:Lyophilised powder
Appearance:White/off-white lyophilised powder
Purity independently verified at a leading Australian university via HPLC & mass spectrometry.
Usage & Storage
Quantity:10mg / vial
Reconstitution:Reconstitute with 2mL bacteriostatic water. Swirl gently; do not shake. Allow to stand until fully dissolved.
Storage Temp:-20°C for long-term storage
Storage Conditions:Store lyophilised powder at -20°C, protected from light and moisture. After reconstitution, refrigerate at 2-8°C and use within 28 days.
Packaging:Sterile, tamper-evident research vial
Description
Tesamorelin is a synthetic analogue of growth hormone-releasing hormone (GHRH) consisting of the full 44 amino acid sequence of endogenous GHRH with a trans-3-hexenoic acid moiety attached to the N-terminus for enhanced stability. It binds to pituitary GHRH receptors to stimulate natural pulsatile growth hormone release while preserving somatostatin feedback mechanisms. Research has investigated its applications in visceral-adiposity, lean-mass, lipid-metabolism, and cognitive-function research.
Frequently Asked Questions
Is Tesamorelin 10mg legal to buy in Australia?
Tesamorelin 10mg is supplied strictly as a research chemical for in-vitro laboratory use. It is not approved for human therapeutic use in Australia and is not for human or animal consumption. Researchers are responsible for compliance with Therapeutic Goods Administration (TGA) regulations and their institution's protocols.
What purity is Tesamorelin 10mg?
We target 99% or higher purity. Every batch is analysed in-house by HPLC and mass spectrometry and ships with a Certificate of Analysis; select batches also undergo independent, third-party purity verification at a leading Australian university.
Does Tesamorelin 10mg ship with a Certificate of Analysis (COA)?
Yes — every batch ships with a batch-specific COA documenting HPLC purity and mass-spectrometry identity. You can view sample reports on our Lab Reports page.
Where can I buy Tesamorelin 10mg in Australia?
Tesamorelin 10mg can be ordered here from Australian Peptide Labs for in-vitro research use, dispatched domestically within Australia with a COA included.
Do you provide dosing or administration guidance for Tesamorelin 10mg?
No. As these compounds are supplied for laboratory research only, we do not provide dosing or administration protocols. Our research library covers reconstitution and concentration calculations for in-vitro work.