Filter: AllWBIHCIF-P
WB analysis using 19142-1-AP
human placenta tissue were subjected to SDS PAGE followed by western blot with 19142-1-AP (GDF8/Myostatin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
Featured Product KD/KO Validated
GDF8/Myostatin Polyclonal antibody
GDF8/Myostatin Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 19142-1-AP
Host / Isotype
Rabbit / IgG
Reactivity
human, mouse and More (5)
Applications
WB, IHC, IF-P, CoIP, ELISA
Synonyms
GDF8, MSTN, myostatin, GDF 8, GDF-8
Formulation: PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate: Unconjugated
Unconjugated
Size/Concentration:
-/ -
Freight/Packing: -
Quantity
Please visit your regions distributor:
Tested Applications
Positive WB detected in human placenta tissue, mouse liver tissue, PC-3 cells, mouse heart tissue Positive IHC detected in human heart tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 Positive IF-P detected in mouse brain tissue
Recommended dilution
Application Dilution Western Blot (WB) WB : 1:500-1:2000 Immunohistochemistry (IHC) IHC : 1:50-1:500 Immunofluorescence (IF)-P IF-P : 1:50-1:500 It is recommended that this reagent should be titrated in each testing system to obtain optimal results. Sample-dependent, Check data in validation data gallery.
Product Information
19142-1-AP targets GDF8/Myostatin in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity human, mouse Cited Reactivity human, mouse, rat, pig, zebrafish, bovine, sheep Host / Isotype Rabbit / IgG Class Polyclonal Type Antibody Immunogen
CatNo: Ag13605
Product name: Recombinant human MSTN protein
Source: e coli.-derived, PGEX-4T
Tag: GST
Domain: 23-375 aa of BC074757
Sequence: LNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Predict reactive species Full Name myostatin Calculated Molecular Weight 375 aa, 43 kDa Observed Molecular Weight 50 and 35 kDa GenBank Accession Number BC074757 Gene Symbol MSTN Gene ID (NCBI) 2660 RRID AB_10638615 Conjugate Unconjugated Form Liquid Purification Method Antigen affinity purification UNIPROT ID O14793 Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.
Background Information
Myostatin, also known as GDF-8, is a member of the TGF-beta superfamily. Myostatin is expressed in the myotome and developing skeletal muscles. Myostatin negatively regulates skeletal muscle growth and development through the regulation of anabolic and catabolic pathways in skeletal muscles. Myostatin immunoreactive bands could be identified at ∼50, 32-35, and 16 kDa, which correspond to the precursor, glycosylated dimmer, and monomer, respectively (PMID: 17711997). GDF8 may have cross-reactions with GDF11.
Publications
All (57) KD/KO (4) WB (45) IHC (8) IF (6) CoIP (1)
Human Mouse Rat Monkey Pig
Species Application Title mouse WB
J Cachexia Sarcopenia Muscle
Potential therapeutic interventions for chronic kidney disease-associated sarcopenia via indoxyl sulfate-induced mitochondrial dysfunction.
View Article mouse WB
Cell Death Dis
Endurance exercise remodels skeletal muscle by suppressing Ythdf1-mediated myostatin expression
View Article Mouse
Br J Pharmacol
A new therapeutic effect of fenofibrate in Duchenne muscular dystrophy: The promotion of myostatin degradation.
View Article mouse WB
Br J Pharmacol
Inhibition of heat shock protein (HSP) 90 reverses signal transducer and activator of transcription (STAT) 3-mediated muscle wasting in cancer cachexia mice.
View Article rat,human WB,IHC,IF
Int J Mol Sci
Renal Ischemia/Reperfusion Early Induces Myostatin and PCSK9 Expression in Rat Kidneys and HK-2 Cells.
KD Validated
View Article mouse WB
iScience
Phosphate depletion in insulin-insensitive skeletal muscle drives AMPD activation and sarcopenia in chronic kidney disease
View Article