From
$49.99
Description Additional information
For In Vitro Research Use Only — Not for Human or Veterinary Use
Molecular Weight
5135.8
Daltons
Amino Acids
44
GHRH Analog
Purity (HPLC)
≥99%
◆Chemical & Physical Specifications
Compound Name Tesamorelin (GHRH Analog) Synonyms TH9507, Tesamorelin Acetate Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (trans-3-hexenoic acid modified) Molecular Formula C221H366N72O67S1 Molecular Weight 5135.8 Da Amino Acid Count 44 (Modified GHRH(1-44) analog) CAS Number 804475-66-9 Purity (HPLC) ≥99% Appearance White to off-white lyophilized powder Solubility Soluble in water, bacteriostatic water Mass Per Vial 10 mg Storage (Lyophilized) -20°C, desiccated, protected from light
◆About Tesamorelin
Tesamorelin is a synthetic 44-amino-acid analog of human growth hormone-releasing hormone (GHRH) with a trans-3-hexenoic acid modification at the N-terminus. This structural modification enhances metabolic stability while preserving full receptor binding affinity, making it a highly selective GHRH receptor agonist studied extensively in endocrine research.
Research interest in tesamorelin centers on its ability to stimulate pulsatile growth hormone (GH) release from the anterior pituitary, which subsequently elevates IGF-1 levels through the GH/IGF-1 axis. Published studies have investigated its effects on body composition parameters, hepatic fat accumulation, and lipid metabolism in various research models.
Tesamorelin is of particular interest to researchers studying the GH/IGF-1 signaling axis because it preserves the physiological pulsatile pattern of GH secretion, unlike exogenous GH administration. This makes it a valuable tool for investigating the downstream effects of endogenous GH release on metabolic endpoints and tissue remodeling.
GH Secretagogue Body Composition Metabolic Research
◆Mechanism of Action
Primary • GHRH Receptor / cAMP-PKA Signaling
Pulsatile Growth Hormone Release
Tesamorelin binds the GHRH receptor on anterior pituitary somatotrophs, activating the cAMP-PKA signaling cascade to stimulate pulsatile GH secretion. This preserves the endogenous diurnal GH release pattern and downstream IGF-1 elevation.
PMID: 41545261 ↗
Secondary • GH/IGF-1 Axis / Lipolysis
Hepatic Fat and Lipid Metabolism
GH released via tesamorelin-stimulated pathways activates hepatic GH receptors, promoting lipolysis and reducing visceral and hepatic fat accumulation. Research demonstrates significant effects on liver fat fraction and lipid panel parameters in controlled studies.
PMID: 41598480 ↗
Tertiary • IGF-1 / Neurotrophic Signaling
Cognitive and Neurotrophic Effects
Elevated IGF-1 resulting from tesamorelin-stimulated GH release has been studied for neurotrophic effects. Research in HIV-associated cognitive impairment models has shown effects on executive function and hippocampal-dependent memory outcomes.
PMID: 39813152 ↗
◆Published Research Highlights
Body Composition 2025
GHRH Analog Effects on Visceral Adipose Tissue
Research demonstrated that tesamorelin-mediated GH release significantly reduced trunk fat mass and visceral adipose tissue volume while preserving lean body mass in controlled studies.
Hepatic Research 2025
Hepatic Fat Reduction via GH/IGF-1 Pathway
Studies of tesamorelin showed significant reductions in hepatic fat fraction as measured by magnetic resonance spectroscopy, with improvements in liver-related biomarkers and fibrosis scores.
Cognition 2024
Neurocognitive Effects of GHRH-Stimulated IGF-1
Research on tesamorelin in HIV-associated neurocognitive models demonstrated improvements in executive function and memory outcomes correlated with IGF-1 elevation, supporting investigation of the GH/IGF-1 axis in neuroprotection.
❄Storage & Stability
Lyophilized
-20°C
Stable for 24+ months when stored desiccated and protected from light
Reconstituted
2-8°C
Use within 14 days; aliquot to avoid repeated freeze-thaw cycles
⚠ Light Sensitive
Protect from direct UV and fluorescent light during reconstitution and storage to prevent peptide degradation
⚠ Avoid Repeated Freeze-Thaw
Multiple freeze-thaw cycles degrade the 44-amino-acid chain. Aliquot reconstituted solution into single-use volumes for best results
◆Reconstitution Protocol
Recommended Solvent: Bacteriostatic Water (0.9% Benzyl Alcohol)
1
Allow to Reach Room Temperature
Remove vial from cold storage. Allow to equilibrate to room temperature for 5 minutes before opening.
2
Add Solvent
Slowly introduce 1-2 mL of bacteriostatic water along the wall of the vial. Do not spray directly onto the lyophilized cake.
3
Gentle Dissolution
Swirl gently until fully dissolved. Do not vortex or shake vigorously, as this may damage the peptide structure.
4
Storage After Reconstitution
Store reconstituted solution at 2-8°C. Use within 14 days for optimal stability. Aliquot into single-use volumes if extended storage is needed.
◆Related Research Compounds
MOTS-c Mitochondrial-derived peptide studied for metabolic regulation and insulin sensitivity via AMPK activation View Compound →
BPC-157 Gastric pentadecapeptide researched for tissue remodeling and cytoprotective effects via multiple growth factor pathways View Compound →
NAD+ Buffered Essential coenzyme for sirtuin activation and mitochondrial function, complementary to GH-axis metabolic research View Compound →
◆Further Reading
Research Profile Tesamorelin: GH-Releasing Research Compound →
Guide Peptide Reconstitution Guide →
◆Frequently Asked Questions What is Tesamorelin and what is it used for in research?
Tesamorelin is a synthetic 44-amino-acid analog of growth hormone-releasing hormone (GHRH) with a trans-3-hexenoic acid modification. It is used in research to study the GH/IGF-1 signaling axis, body composition changes, hepatic fat metabolism, and neurocognitive outcomes associated with pulsatile GH release. What purity level is this compound?
Our Tesamorelin is verified at ≥99% purity via HPLC analysis. Every vial ships with a Certificate of Analysis confirming purity, identity, and mass specifications. How should I reconstitute and store this compound?
Reconstitute with bacteriostatic water (0.9% benzyl alcohol) by slowly introducing solvent along the vial wall. Swirl gently until dissolved. Store the lyophilized powder at -20°C and reconstituted solution at 2-8°C. Use reconstituted solution within 14 days. Do you provide a Certificate of Analysis?
Yes. Every vial of Tesamorelin includes a Certificate of Analysis (COA) with third-party HPLC verification, mass spectrometry confirmation, and endotoxin testing results. COAs are also available as QR codes on physical vials. What payment methods do you accept?
We accept Zelle, Venmo, and cryptocurrency (Bitcoin and Litecoin via BTCPay Server). All transactions are processed securely through our self-hosted payment infrastructure.
Research Use Only
This product is intended solely for in vitro research and laboratory use. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease. The purchaser assumes all responsibility for the use of this product.
Legal Disclaimer
Product descriptions are based on published research literature and do not constitute medical claims. IDUN Peptides makes no claims regarding the efficacy of these compounds for any purpose other than in vitro research.
Terms of Sale
By purchasing, you confirm that you are at least 18 years of age and that this compound will be used exclusively for legitimate research purposes. All sales are subject to our Terms & Conditions.
📄 Certificate of Analysis Included With Every Order
mass
10mg (10 Vials), 10mg (5 Vials), 10mg (Single Vial)