IGF1-LR3 1mg
Research Handling Note:
For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.
Stock: 655
Model: IGF1-LR3 1mg
Molecular Formula: C400H625N111O115S9
SKU: IGFLR-022
Research Only: Yes
Certificate of analysis
Description
Technical Data
IGF LR3 (Long arginine 3-IGF-1) 1mg - High-Quality Research Peptide
Long arginine 3-IGF-1 (IGF-1 LR3), offered at 1mg, is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.
Product Name: IGF LR3 1mg
Catalogue Number: IGF1LR3-1mg
Molecular Weight: 9117.60 g/mol
Purity: ≥98%
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Form: Lyophilised Solid
Usage and Storage:
Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance:
Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
UK-Peptides proudly provides Long arginine 3-IGF-1 (IGF-1 LR3) strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application.
If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.
Identification
Molecular Weight (g/mol)
9117.60 g/mol
Physical and Chemical Properties
Molecular Formula
C400H625N111O115S9
Physical Appearance
White lyophilised solid
Form
Sterile filtered white lyophilized (freeze-dried)
Solubility
Aqueous soluble
Appearance
White to off-white lyophilised powder
Melting Point
Not applicable (decomposes before melting)
Analytical and Quality Control
HPLC Result
shows min 98% Purity
Mass Spectrum
Consistent with structure
Purity %
>98%
Research Use and Safety
Caution
Research use only / Not for human or veterinary use
Intended Use
For laboratory research use only. Not for human or veterinary use.
Hazard Classification
Not classified as hazardous under GHS for research quantities
Storage, Handling and Stability
Storage Temperature, Opened
Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Storage Temperature, Unopened
-20 °C recommended for long-term storage
Shelf Life
2 years unopened under recommended conditions
Reconstitution Stability
Stable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions