Peptides of London
TB500 5mg
TB500 5mg
Regular price £34.99 GBP
Regular price Sale price £34.99 GBP
Unit price per
Sale Sold out
Taxes included. Shipping calculated at checkout.
Quantity (0 in cart)
Couldn't load pickup availability
Product Name: TB500 5mg Molecular Formula: C212H350N56O78S Molecular Weight: 4963.4 g/mol Purity: ≥98% Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Form: Lyophilised Solid CAS number: 77591-33-4
Reconstitute with: Bacteriostatic water
Usage and Storage
Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°c for a limited period of time. The lyophilised protein remains stable until expiry date when stored at -20°c. View full details